Structure of PDB 3iab Chain B Binding Site BS01

Receptor Information
>3iab Chain B (length=107) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYV
AVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVIQLKKRAVSG
VELRIYV
Ligand information
>3iab Chain R (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacucaguaauaugcuuuggaaacgaagcuuacaaaauggagucc
<<<<<<........<<<<<......>>>>>..........>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3iab Eukaryotic ribonucleases P/MRP: the crystal structure of the P3 domain
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R14 S20 K22 I33 F34 V35 K36 S37 T39 P40 Y41 V42 S43 K46 R47 L66 G67 M68 K70 E73 K74 T96 I97 V99 R129 A130 S132
Binding residue
(residue number reindexed from 1)		R1 S7 K9 I20 F21 V22 K23 S24 T26 P27 Y28 V29 S30 K33 R34 L53 G54 M55 K57 E60 K61 T83 I84 V86 R96 A97 S99
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3iab, PDBe:3iab, PDBj:3iab
PDBsum3iab
PubMed20075859
UniProtP38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)

[Back to BioLiP]