Structure of PDB 3hzi Chain B Binding Site BS01

Receptor Information
>3hzi Chain B (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCDAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hzi Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		T27 Q28 Q39 S43
Binding residue
(residue number reindexed from 1)		T24 Q25 Q36 S40
Binding affinityPDBbind-CN: Kd=15uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0040008 regulation of growth
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hzi, PDBe:3hzi, PDBj:3hzi
PDBsum3hzi
PubMed19150849
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]