Structure of PDB 3hsv Chain B Binding Site BS01

Receptor Information
>3hsv Chain B (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSLKWCLRVNPKGLDEESKD
YLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWG
FKKFIRRGFLLDEANGLLPDDKLTLFCEVSVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hsv Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
Resolution1.43 Å
Binding residue
(original residue number in PDB)
Y87 Y123 W131 G132 F133 K134
Binding residue
(residue number reindexed from 1)
Y55 Y91 W99 G100 F101 K102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3hsv, PDBe:3hsv, PDBj:3hsv
PDBsum3hsv
PubMed19818708
UniProtQ5NVK7|SPOP_PONAB Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]