Structure of PDB 3h91 Chain B Binding Site BS01

Receptor Information
>3h91 Chain B (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAF
QK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h91 Recognition and specificity determinants of the human cbx chromodomains.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
V11 F12 A14 E15 W33 R34 W36 E44 N48 L50 D51 R53 L54
Binding residue
(residue number reindexed from 1)
V3 F4 A6 E7 W25 R26 W28 E36 N40 L42 D43 R45 L46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3h91, PDBe:3h91, PDBj:3h91
PDBsum3h91
PubMed21047797
UniProtQ14781|CBX2_HUMAN Chromobox protein homolog 2 (Gene Name=CBX2)

[Back to BioLiP]