Structure of PDB 3h1p Chain B Binding Site BS01

Receptor Information
>3h1p Chain B (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD
VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVT
PIKDLTAHFRGDRSKTLLEKPKLFFIQACRGTELDDGIQYKAPVEADFLF
AYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVAR
HFESQSDDPHFHEKKQIPCVVSMLTKELYFSQH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h1p L2' loop is critical for caspase-7 active site formation.
Resolution2.61 Å
Binding residue
(original residue number in PDB)		R87 H144 Q184 C186 Y230 S231 W232 R233 S234 P235 Q276
Binding residue
(residue number reindexed from 1)		R30 H87 Q127 C129 Y159 S160 W161 R162 S163 P164 Q205
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G28 V29 H87 G88 C129
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3h1p, PDBe:3h1p, PDBj:3h1p
PDBsum3h1p
PubMed19530232
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]