Structure of PDB 3h11 Chain B Binding Site BS01

Receptor Information
>3h11 Chain B (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTT
TFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGI
IYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQQTRYIP
DEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILT
EVNYEVSNKGKQMPQPTFTLRKKLVFPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h11 Mechanism of procaspase-8 activation by c-FLIPL.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R243 R245 H302 C345 S396 Y397 R398 P400
Binding residue
(residue number reindexed from 1)		R36 R38 H95 C138 S167 Y168 R169 P171
Enzymatic activity
Catalytic site (original residue number in PDB) R243 D244 H302 G303 C345 Q346
Catalytic site (residue number reindexed from 1) R36 D37 H95 G96 C138 Q139
Enzyme Commision number 3.4.22.61: caspase-8.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3h11, PDBe:3h11, PDBj:3h11
PDBsum3h11
PubMed19416807
UniProtQ14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]