Structure of PDB 3gz2 Chain B Binding Site BS01

Receptor Information
>3gz2 Chain B (length=143) Species: 623 (Shigella flexneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVF
FRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVF
HTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gz2 Combination of two separate binding domains defines stoichiometry between type III secretion system chaperone IpgC and translocator protein IpaB
Resolution2.65 Å
Binding residue
(original residue number in PDB)		Y40 Y44 Y47 H109 K142
Binding residue
(residue number reindexed from 1)		Y32 Y36 Y39 H101 K134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3gz2, PDBe:3gz2, PDBj:3gz2
PDBsum3gz2
PubMed20937829
UniProtP0A2U4|IPGC_SHIFL Chaperone protein IpgC (Gene Name=ipgC)

[Back to BioLiP]