Structure of PDB 3gw1 Chain B Binding Site BS01

Receptor Information

>3gw1 Chain B (length=82) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCG
VYTYEVAETKVAQVIDSARRHQHPLQCTMEKD

Ligand information

>3gw1 Chain D (length=2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3gw1 Molecular basis of substrate selection by the N-end rule adaptor protein ClpS.
Resolution	2.36 Å
Binding residue (original residue number in PDB)	N47 D48 T51 P52 M53 V78 H79
Binding residue (residue number reindexed from 1)	N10 D11 T14 P15 M16 V41 H42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006508	proteolysis
GO:0030163	protein catabolic process

View graph for
Biological Process

External links

PDB	RCSB:3gw1, PDBe:3gw1, PDBj:3gw1
PDBsum	3gw1
PubMed	19451643
UniProt	A0A290MK63

[Back to BioLiP]