Structure of PDB 3gsn Chain B Binding Site BS01

Receptor Information

>3gsn Chain B (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVG
AGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGIY
GYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFF
PDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFW
QNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Ligand information

>3gsn Chain P (length=9) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NLVPMVATV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3gsn Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	E30 T97 G98 G99
Binding residue (residue number reindexed from 1)	E29 T96 G97 G98

External links

PDB	RCSB:3gsn, PDBe:3gsn, PDBj:3gsn
PDBsum	3gsn
PubMed	19542454

[Back to BioLiP]