Structure of PDB 3gep Chain B Binding Site BS01

Receptor Information
>3gep Chain B (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDV
MKEMHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYC
NDQSTGDIKVIGGDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKM
VKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCV
ISETGKAKYKA
Ligand information
Ligand ID24H
InChIInChI=1S/C9H14N5O6P/c10-9-12-7-6(8(16)13-9)11-3-14(7)1-5(2-15)20-4-21(17,18)19/h3,5,15H,1-2,4H2,(H2,17,18,19)(H3,10,12,13,16)/t5-/m0/s1
InChIKeyVXDNQJCXIVLMQW-YFKPBYRVSA-N
SMILES
SoftwareSMILES
CACTVS 3.341NC1=Nc2n(C[C@@H](CO)OC[P](O)(O)=O)cnc2C(=O)N1
OpenEye OEToolkits 1.5.0c1nc2c(n1CC(CO)OCP(=O)(O)O)N=C(NC2=O)N
OpenEye OEToolkits 1.5.0c1nc2c(n1C[C@@H](CO)OCP(=O)(O)O)N=C(NC2=O)N
CACTVS 3.341NC1=Nc2n(C[CH](CO)OC[P](O)(O)=O)cnc2C(=O)N1
ACDLabs 10.04O=P(O)(O)COC(CO)Cn1c2N=C(NC(=O)c2nc1)N
FormulaC9 H14 N5 O6 P
Name{[(1S)-2-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-1-(hydroxymethyl)ethoxy]methyl}phosphonic acid
ChEMBLCHEMBL419692
DrugBank
ZINC
PDB chain3gep Chain B Residue 218 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gep Inhibition of hypoxanthine-guanine phosphoribosyltransferase by acyclic nucleoside phosphonates: a new class of antimalarial therapeutics.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D137 T138 G139 T141 K165 F186 V187
Binding residue
(residue number reindexed from 1)		D131 T132 G133 T135 K159 F180 V181
Annotation score1
Enzymatic activity
Catalytic site (original residue number in PDB) E133 D134 D137 F186 R199
Catalytic site (residue number reindexed from 1) E127 D128 D131 F180 R193
Enzyme Commision number 2.4.2.8: hypoxanthine phosphoribosyltransferase.
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0005515 protein binding
GO:0016757 glycosyltransferase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0052657 guanine phosphoribosyltransferase activity
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001975 response to amphetamine
GO:0006164 purine nucleotide biosynthetic process
GO:0006166 purine ribonucleoside salvage
GO:0006178 guanine salvage
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0021756 striatum development
GO:0021895 cerebral cortex neuron differentiation
GO:0021954 central nervous system neuron development
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0042417 dopamine metabolic process
GO:0043103 hypoxanthine salvage
GO:0044209 AMP salvage
GO:0045964 positive regulation of dopamine metabolic process
GO:0046038 GMP catabolic process
GO:0046040 IMP metabolic process
GO:0046083 adenine metabolic process
GO:0046100 hypoxanthine metabolic process
GO:0046651 lymphocyte proliferation
GO:0048813 dendrite morphogenesis
GO:0051289 protein homotetramerization
GO:0071542 dopaminergic neuron differentiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gep, PDBe:3gep, PDBj:3gep
PDBsum3gep
PubMed19527031
UniProtP00492|HPRT_HUMAN Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=HPRT1)

[Back to BioLiP]