Structure of PDB 3g8s Chain B Binding Site BS01

Receptor Information
>3g8s Chain B (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>3g8s Chain Q (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaccauugcacuccggugccaguugacgaggugggguuuaucgagauu
ucggcggaugacucccgguuguucaucacaaccgcaagcuuuuacuuaaa
ucauuaaggugacuuaguggacaaaggugaaagugugauga
<<<<<<..........>>>>>>......(((...<<<<<<..))).....
.........>>>>>><<<<<<...((((>>>>>>...<<<<<<<<<....
<<<<<<<<....>>>>>>>.>....>>>>>>>>>.))))..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g8s Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 D24 S48 L49 K50 M51 R52 Q54 F56 K80 R83 Q85 Y86 A87 K88 S91 D92
Binding residue
(residue number reindexed from 1)		Y9 N11 N12 E15 K18 D20 S44 L45 K46 M47 R48 Q50 F52 K76 R79 Q81 Y82 A83 K84 S87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3g8s, PDBe:3g8s, PDBj:3g8s
PDBsum3g8s
PubMed19228039
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]