Structure of PDB 3g6n Chain B Binding Site BS01

Receptor Information
>3g6n Chain B (length=183) Species: 1352 (Enterococcus faecium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMMITMDDIIREGNPTLREVAKEVSLPLSEEDISLGKEMLEFLKNSQD
PIKAEELHLRGGVGLAAPQLDISKRIIAVHVPSSLSTVMYNPKILSHSVQ
DACLGEGEGCLSVDREVPGYVVRHAKITVSYYDMNGEKHKIRLKNYESIV
VQHEIDHINGVMFYDHINDQNPFALKEGVLVIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g6n Crystal structure of an EfPDF complex with Met-Ala-Ser based on crystallographic packing.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G57 G58 V59 G113 C114 L115 H157
Binding residue
(residue number reindexed from 1)		G61 G62 V63 G109 C110 L111 H153
Enzymatic activity
Catalytic site (original residue number in PDB) G60 Q65 C114 L115 H157 E158 H161
Catalytic site (residue number reindexed from 1) G64 Q69 C110 L111 H153 E154 H157
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0042586 peptide deformylase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0018206 peptidyl-methionine modification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g6n, PDBe:3g6n, PDBj:3g6n
PDBsum3g6n
PubMed19249287
UniProtQ842S4

[Back to BioLiP]