Structure of PDB 3g5v Chain B Binding Site BS01

Receptor Information

>3g5v Chain B (length=200) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMG
YISYSGNTRYNPSLKSRISITRDTSSNQFFLQLNSVTIEDTATYYCVTAG
RGFPYWGQGTLVTVSAAKTTPPSVYPLAPTLGCLVKGYFPESVTVTANSG
SLSVHTFPALLQSDLYTMSSSVTVPSSTWSETVTCSVAHPASSTTVDKKA

Ligand information

>3g5v Chain C (length=16) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CGADSYEMEEDGVRKC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3g5v Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
Resolution	2.001 Å
Binding residue (original residue number in PDB)	D32 F33 A34 Y51 Y54 A99 G100 R101
Binding residue (residue number reindexed from 1)	D32 F33 A34 Y51 Y54 A99 G100 R101

External links

PDB	RCSB:3g5v, PDBe:3g5v, PDBj:3g5v
PDBsum	3g5v
PubMed	19289842

[Back to BioLiP]