Structure of PDB 3g1b Chain B Binding Site BS01

Receptor Information
>3g1b Chain B (length=81) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGV
YTYEVAETKVAQVIDSARRHQHPLQCTMEKD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g1b Molecular basis of substrate selection by the N-end rule adaptor protein ClpS.
Resolution1.448 Å
Binding residue
(original residue number in PDB)		L46 N47 D48 T51 P52 A53 V56 M75 V78 H79 L112
Binding residue
(residue number reindexed from 1)		L8 N9 D10 T13 P14 A15 V18 M37 V40 H41 L74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006508 proteolysis
GO:0030163 protein catabolic process

View graph for
Biological Process
External links
PDB RCSB:3g1b, PDBe:3g1b, PDBj:3g1b
PDBsum3g1b
PubMed19451643
UniProtQ9A5I0|CLPS_CAUVC ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]