Structure of PDB 3fhv Chain B Binding Site BS01

Receptor Information

>3fhv Chain B (length=150) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGTELTNYQTLATNTIGMMKGVDGYAFTSGAKMTDTLIQAGAAKGMTVSG
DPASGSATLWNSWGGQIVVAPDTAGGTGFNNGFTITTNKVPQSACVSIST
GMSRSGGTSGIKINGNNHTDAKVTAEIASSECTADNGRTGTNTLVFNYNG

Ligand information

>3fhv Chain C (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SYDPDNKEER

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3fhv Structural basis of typhoid: Salmonella typhi type IVb pilin (PilS) and cystic fibrosis transmembrane conductance regulator interaction.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	W91 G95 G96 Q97 N119 K120 T174
Binding residue (residue number reindexed from 1)	W60 G64 G65 Q66 N88 K89 T143

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3fhv, PDBe:3fhv, PDBj:3fhv
PDBsum	3fhv
PubMed	19626704
UniProt	Q8Z1L1

[Back to BioLiP]