Structure of PDB 3fhp Chain B Binding Site BS01

Receptor Information

>3fhp Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>3fhp Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3fhp A neutron crystallographic analysis of T6 porcine insulin at 2.1 A resolution
Resolution	2.0 Å
Binding residue (original residue number in PDB)	F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 K29
Binding residue (residue number reindexed from 1)	F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 K29

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3fhp, PDBe:3fhp, PDBj:3fhp
PDBsum	3fhp
PubMed	19770501
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]