Structure of PDB 3fdq Chain B Binding Site BS01

Receptor Information
>3fdq Chain B (length=140) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFY
QAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSL
NDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fdq Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
Y121 K124 P138 G139 R140 R142 K143
Binding residue
(residue number reindexed from 1)
Y118 K121 P135 G136 R137 R139 K140
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3fdq, PDBe:3fdq, PDBj:3fdq
PDBsum3fdq
PubMed19446532
UniProtP0DJO8|MOGR_LISMO Motility gene repressor MogR (Gene Name=mogR)

[Back to BioLiP]