Structure of PDB 3fc3 Chain B Binding Site BS01

Receptor Information
>3fc3 Chain B (length=188) Species: 85963 (Helicobacter pylori J99) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSEL
EAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECR
KNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNH
DTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fc3 Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		K61 N83 D86 A87 K88 R94 P95 R101 V146 H147 H149 N165 T166 G169 R170
Binding residue
(residue number reindexed from 1)		K60 N82 D85 A86 K87 R93 P94 R100 V145 H146 H148 N164 T165 G168 R169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3fc3, PDBe:3fc3, PDBj:3fc3
PDBsum3fc3
PubMed19380375
UniProtQ9ZL26

[Back to BioLiP]