Structure of PDB 3ery Chain B Binding Site BS01

Receptor Information
>3ery Chain B (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDARITQVAKGQE
QWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGC
DYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ery Different thermodynamic binding mechanisms and peptide fine specificities associated with a panel of structurally similar high-affinity T cell receptors
Resolution1.95 Å
Binding residue
(original residue number in PDB)
W73 N77 L81 Y84 R97 Y99 T143 K146 W147 A152 Y155
Binding residue
(residue number reindexed from 1)
W52 N56 L60 Y63 R76 Y78 T122 K125 W126 A131 Y134
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ery, PDBe:3ery, PDBj:3ery
PDBsum3ery
PubMed18973345
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]