Structure of PDB 3eov Chain B Binding Site BS01

Receptor Information
>3eov Chain B (length=166) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGY
KDSIFHRVIQNFMIQGGDFTNFDGTGGKSIYGEKFADENLNVKHFVGALS
MANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDVVLRIEKTKTNS
HDRPVKPVKIVASGEL
Ligand information
>3eov Chain D (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3eov Structure of Cyclophilin from Leishmania Donovani Bound to Cyclosporin at 2.6 A Resolution: Correlation between Structure and Thermodynamic Data.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R78 F83 Q86 G95 A123 N124 Q133 F135 W143 H148
Binding residue
(residue number reindexed from 1)		R57 F62 Q65 G74 A102 N103 Q112 F114 W122 H127
Enzymatic activity
Catalytic site (original residue number in PDB) R78 F83 Q86 N124 F135 L144 H148
Catalytic site (residue number reindexed from 1) R57 F62 Q65 N103 F114 L123 H127
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3eov, PDBe:3eov, PDBj:3eov
PDBsum3eov
PubMed19923714
UniProtQ9U9R3

[Back to BioLiP]