Structure of PDB 3ejh Chain B Binding Site BS01

Receptor Information
>3ejh Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSE
TGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL
Ligand information
>3ejh Chain F (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GQRVVGLPGQRGERGFPGLPGY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ejh Identification and structural analysis of type I collagen sites in complex with fibronectin fragments.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D516 K533 H539 R550 G551 R552 W553 C555 P557 F569 I594 E596 W597
Binding residue
(residue number reindexed from 1)		D1 K18 H24 R35 G36 R37 W38 C40 P42 F54 I79 E81 W82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:3ejh, PDBe:3ejh, PDBj:3ejh
PDBsum3ejh
PubMed19251642
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]