Structure of PDB 3eg1 Chain B Binding Site BS01

Receptor Information

>3eg1 Chain B (length=56) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
QYITPV

Ligand information

>3eg1 Chain D (length=10) Species: 32630 (synthetic construct)

APSYSPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3eg1 Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
• Resolution: 1.85 Å
• Binding residue (original residue number in PDB): Y70 D77 E98 W99 W110 P112 Y115
• Binding residue (residue number reindexed from 1): Y7 D14 E35 W36 W47 P49 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:3eg1, PDBe:3eg1, PDBj:3eg1
• PDBsum: 3eg1
• PubMed: 19906645
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)