Structure of PDB 3ech Chain B Binding Site BS01

Receptor Information

>3ech Chain B (length=135) Species: 287 (Pseudomonas aeruginosa)

MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQR
GLNLQDLGRQMITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHL
HAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAA

Ligand information

>3ech Chain C (length=24) Species: 287 (Pseudomonas aeruginosa)

RDYTEQLRRAARRNAWDLYGEHFY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3ech The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR
• Resolution: 1.802 Å
• Binding residue (original residue number in PDB): M10 P11 A12 M14 A15 F17 Q18 V20 R21 I24 L28 P37 H41 H116
• Binding residue (residue number reindexed from 1): M10 P11 A12 M14 A15 F17 Q18 V20 R21 I24 L28 P37 H41 H110

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0034763 negative regulation of transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0050709 negative regulation of protein secretion

Cellular Component

• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3ech, PDBe:3ech, PDBj:3ech
• PDBsum: 3ech
• PubMed: 18812515
• UniProt: P52003|MEXR_PSEAE Multidrug resistance operon repressor (Gene Name=mexR)