Structure of PDB 3ebc Chain B Binding Site BS01

Receptor Information
>3ebc Chain B (length=244) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKAGEPFEKLVYKFLKENLSDLTFKQYEYLND
LFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDT
ADILLVKDQFYELLDVKTRNISAQAPAIISAYKLAQTCAKMIDNKEFDLF
DINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRD
LDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ebc Early Interrogation and Recognition of DNA Sequence by Indirect Readout
Resolution2.55 Å
Binding residue
(original residue number in PDB)
Q109 N110 D111 Q138 I143 S144 Y146 K147 A205 M206 Q207
Binding residue
(residue number reindexed from 1)
Q97 N98 D99 Q124 I129 S130 Y132 K133 A191 M192 Q193
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3ebc, PDBe:3ebc, PDBj:3ebc
PDBsum3ebc
PubMed19081059
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]