Structure of PDB 3e45 Chain B Binding Site BS01

Receptor Information
>3e45 Chain B (length=249) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRGHAAGEPFEKLVYKFLKENLSDLTFKQYE
YLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEK
QNDTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDN
KEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQI
QFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e45 DNA distortion and specificity in a sequence-specific endonuclease.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		H31 A33 Q109 N110 D127 K129 S136 A137 F138 P140 N141 S144 Y146 K147 A205 Q207
Binding residue
(residue number reindexed from 1)		H23 A25 Q101 N102 D119 K121 S128 A129 F130 P132 N133 S136 Y138 K139 A197 Q199
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3e45, PDBe:3e45, PDBj:3e45
PDBsum3e45
PubMed18762194
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]