Structure of PDB 3e2h Chain B Binding Site BS01

Receptor Information
>3e2h Chain B (length=109) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYS
GDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSLERPYLTF
GSGTKVIVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e2h Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R101 P102
Binding residue
(residue number reindexed from 1)		R95 P96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0042101 T cell receptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3e2h, PDBe:3e2h, PDBj:3e2h
PDBsum3e2h
PubMed18941216
UniProtP01738|TVA1_MOUSE T-cell receptor alpha chain V region PHDS58

[Back to BioLiP]