Structure of PDB 3e1r Chain B Binding Site BS01

Receptor Information

>3e1r Chain B (length=42) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKK

Ligand information

>3e1r Chain C (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QAQGPPYPTYPGY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3e1r Midbody targeting of the ESCRT machinery by a noncanonical coiled coil in CEP55.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	N181 E192
Binding residue (residue number reindexed from 1)	N15 E26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0000281	mitotic cytokinesis
GO:0051896	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process

External links

PDB	RCSB:3e1r, PDBe:3e1r, PDBj:3e1r
PDBsum	3e1r
PubMed	18948538
UniProt	Q53EZ4\|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]