Structure of PDB 3e0n Chain B Binding Site BS01

Receptor Information
>3e0n Chain B (length=251) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKE
AYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPI
TFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVP
LISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSC
PVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVP
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e0n Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		H57 G98 S99 E172H P172I D189 A190 C191 Q192 S195 S214 W215 G216 D217
Binding residue
(residue number reindexed from 1)		H41 G86 S87 E169 P170 D188 A189 C190 Q191 S194 S213 W214 G215 D216
Enzymatic activity
Catalytic site (original residue number in PDB) D102
Catalytic site (residue number reindexed from 1) D90
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3e0n, PDBe:3e0n, PDBj:3e0n
PDBsum3e0n
PubMed19388054
UniProtQ16651|PRSS8_HUMAN Prostasin (Gene Name=PRSS8)

[Back to BioLiP]