Structure of PDB 3dpq Chain B Binding Site BS01

Receptor Information
>3dpq Chain B (length=212) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHV
LQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKD
KNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGD
HLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQE
LAQVSQKLMEIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dpq Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T403 M404 F426 S427 T428 A429 Q433 A435 V436 T437 N458 G468 I472
Binding residue
(residue number reindexed from 1)		T13 M14 F36 S37 T38 A39 Q43 A45 V46 T47 N68 G78 I82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:3dpq, PDBe:3dpq, PDBj:3dpq
PDBsum3dpq
PubMed19103929
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]