Structure of PDB 3dfx Chain B Binding Site BS01

Receptor Information
>3dfx Chain B (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMK
KEGIQTRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dfx Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R329 R330 R364 N365
Binding residue
(residue number reindexed from 1)		R22 R23 R57 N58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3dfx, PDBe:3dfx, PDBj:3dfx
PDBsum3dfx
PubMed18621058
UniProtP23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=Gata3)

[Back to BioLiP]