Structure of PDB 3dcg Chain B Binding Site BS01

Receptor Information
>3dcg Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYVKLISSDGHEFIVKREHALTSGTIKAMLTNEVNFREIPSHVLSKVCMY
FTYKVRYTNSEIPEFPIAPEIALELLMAANFLDC
Ligand information
>3dcg Chain F (length=16) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NKVGSLQYLALAALIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dcg Structural insight into the human immunodeficiency virus Vif SOCS box and its role in human E3 ubiquitin ligase assembly
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y76 Y83 N85 S86 E89 I90 I95 A100 L104 A107 N108 C112
Binding residue
(residue number reindexed from 1)		Y50 Y57 N59 S60 E61 I62 I67 A72 L76 A79 N80 C84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process

View graph for
Biological Process
External links
PDB RCSB:3dcg, PDBe:3dcg, PDBj:3dcg
PDBsum3dcg
PubMed18562529
UniProtQ15369|ELOC_HUMAN Elongin-C (Gene Name=ELOC)

[Back to BioLiP]