Structure of PDB 3d9t Chain B Binding Site BS01

Receptor Information
>3d9t Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCF
CCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d9t The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		D297 K299 G306 L307 R308 W310 D314 E319 W323
Binding residue
(residue number reindexed from 1)		D46 K48 G55 L56 R57 W59 D63 E68 W72
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3d9t, PDBe:3d9t, PDBj:3d9t
PDBsum3d9t
PubMed19153467
UniProtQ13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 (Gene Name=BIRC2)

[Back to BioLiP]