Structure of PDB 3d9l Chain B Binding Site BS01

Receptor Information
>3d9l Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKF
IQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLY
RCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d9l Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
E10 S13
Binding residue
(residue number reindexed from 1)
E10 S13
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3d9l, PDBe:3d9l, PDBj:3d9l
PDBsum3d9l
PubMed18550522
UniProtQ9UPN6|SCAF8_HUMAN SR-related and CTD-associated factor 8 (Gene Name=SCAF8)

[Back to BioLiP]