Structure of PDB 3d0a Chain B Binding Site BS01

Receptor Information

>3d0a Chain B (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQ
LWVDSTPPPGTRVRAMAIYKQSQRMTEVVRRCPHHERCSDSDGLAPPQHL
IRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMG
GMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK

Ligand information

>3d0a Chain E (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggcatgcccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3d0a Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
Resolution	1.8 Å
Binding residue (original residue number in PDB)	S241 R273 C275 A276 C277 R280
Binding residue (residue number reindexed from 1)	S147 R179 C181 A182 C183 R186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3d0a, PDBe:3d0a, PDBj:3d0a
PDBsum	3d0a
PubMed	18996393
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]