Structure of PDB 3cz3 Chain B Binding Site BS01

Receptor Information
>3cz3 Chain B (length=56) Species: 12315 (Tomato aspermy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHA
RQVELS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cz3 Structural Basis for siRNA Recognition by 2b, a Viral Suppressor of Non-Cell Autonomous RNA Silencing
Resolution3.23 Å
Binding residue
(original residue number in PDB)		K14 K21 R28 H29 N32 R33 R36 H38 S40 P41 S42 R46 W50
Binding residue
(residue number reindexed from 1)		K12 K19 R26 H27 N30 R31 R34 H36 S38 P39 S40 R44 W48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cz3, PDBe:3cz3, PDBj:3cz3
PDBsum3cz3
PubMed
UniProtQ8UYT3|2B_TAV Suppressor of silencing 2b (Gene Name=ORF2b)

[Back to BioLiP]