Structure of PDB 3cun Chain B Binding Site BS01

Receptor Information
>3cun Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3cun Chain D (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauggcgaaagccauuuccgcaggccccauugcacuccgggguauuggc
guuagguggugguacgagguucgaauccucguaccgcagcca
<<<<<<<....>>>>>>.><<<..<<<<<..........>>>>>....>>
>...<<<.<<<<<<<<<<<.......>>>>>>>>>>>.>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cun Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y408 N410 N411 E414 S443 L444 K445 M446 R447 Q449 F451 R478 Q480 A482 K483 T484 D485 S486 D487
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 S43 L44 K45 M46 R47 Q49 F51 R78 Q80 A82 K83 T84 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3cun, PDBe:3cun, PDBj:3cun
PDBsum3cun
PubMed18548004
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]