Structure of PDB 3cul Chain B Binding Site BS01

Receptor Information
>3cul Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3cul Chain D (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauggcgaaagccauuuccgcaggccccauugcacuccgggguauuggc
guuagguggugguacgagguucgaauccucguaccgcagcca
<<<<<<<....>>>>>>.><<<..<<<<<..........>>>>>....>>
>...<<<.<<<<<<<<<<<.......>>>>>>>>>>>.>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cul Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y408 N411 E414 S443 L444 K445 M446 R447 Q449 F451 K475 Q480 Y481 K483 D485 S486 D487
Binding residue
(residue number reindexed from 1)		Y8 N11 E14 S43 L44 K45 M46 R47 Q49 F51 K75 Q80 Y81 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3cul, PDBe:3cul, PDBj:3cul
PDBsum3cul
PubMed18548004
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]