Structure of PDB 3crp Chain B Binding Site BS01

Receptor Information
>3crp Chain B (length=34) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVKQLEDAVEELLSANYHLENAVARLKKLVGER
Ligand information
>3crp Chain E (length=29) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKQLEDAVEELLSANYHLENAVARLKKLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3crp A heterospecific leucine zipper tetramer.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
M1 K4 D8
Binding residue
(residue number reindexed from 1)
M1 K4 D8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3crp, PDBe:3crp, PDBj:3crp
PDBsum3crp
PubMed18804028
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]