Structure of PDB 3crf Chain B Binding Site BS01

Receptor Information
>3crf Chain B (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVN
STTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDST
EKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Ligand information
>3crf Chain C (length=19) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSFLPNSEQQKSVDIVFSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3crf Structural analysis of the Saf pilus by electron microscopy and image processing.
Resolution17.0 Å
Binding residue
(original residue number in PDB)		P20 Q21 L23 L27 P29 L33 K34 A35 K79 W103 W108 V128 A130 D131 T132 Y133 P134 I135 T136 L137 D138 V139 G141 Y142 Q143
Binding residue
(residue number reindexed from 1)		P20 Q21 L23 L27 P29 L33 K34 A35 K79 W103 W108 V128 A130 D131 T132 Y133 P134 I135 T136 L137 D138 V139 G141 Y142 Q143
Enzymatic activity
Enzyme Commision number ?
External links