Structure of PDB 3cre Chain B Binding Site BS01

Receptor Information
>3cre Chain B (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVN
STTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDST
EKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Ligand information
>3cre Chain C (length=19) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSFLPNSEQQKSVDIVFSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cre Structural analysis of the Saf pilus by electron microscopy and image processing.
Resolution17.0 Å
Binding residue
(original residue number in PDB)		S19 V25 L27 P29 L33 K34 A35 W103 W108 A130 T132 Y133 I135 T136 L137 D138 V139 V140 G141 Y142 Q143 P144
Binding residue
(residue number reindexed from 1)		S19 V25 L27 P29 L33 K34 A35 W103 W108 A130 T132 Y133 I135 T136 L137 D138 V139 V140 G141 Y142 Q143 P144
Enzymatic activity
Enzyme Commision number ?
External links