Structure of PDB 3bzv Chain B Binding Site BS01

Receptor Information
>3bzv Chain B (length=80) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLAR
SLYKNIHKGQYITEDFFEPVAQLIRIAIDL
Ligand information
>3bzv Chain A (length=24) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLHSEIQSGSLANNIKKSTVIVKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bzv Structural analysis of the essential self-cleaving type III secretion proteins EscU and SpaS.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		A264 H265 I266 A267 I268 C269 L270 Y271 Y272 I283 Q293 I295 L297 A298 Y301 I303 P304 V305 I306 E307 D308 I309 A312 G322 Q323 Y324 A340
Binding residue
(residue number reindexed from 1)		A1 H2 I3 A4 I5 C6 L7 Y8 Y9 I20 Q30 I32 L34 A35 Y38 I40 P41 V42 I43 E44 D45 I46 A49 G59 Q60 Y61 A77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bzv, PDBe:3bzv, PDBj:3bzv
PDBsum3bzv
PubMed18451864
UniProtQ9AJ26

[Back to BioLiP]