Structure of PDB 3bzo Chain B Binding Site BS01

Receptor Information
>3bzo Chain B (length=82) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLAR
SLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY
Ligand information
>3bzo Chain A (length=17) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGSLANNIKKSTVIVKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bzo Structural analysis of the essential self-cleaving type III secretion proteins EscU and SpaS.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		H265 I266 A267 I268 C269 L270 Y271 Y272 E284 A298 Y301 I303 P304 V305 I306 E307 D308 I309 A312 A340
Binding residue
(residue number reindexed from 1)		H2 I3 A4 I5 C6 L7 Y8 Y9 E21 A35 Y38 I40 P41 V42 I43 E44 D45 I46 A49 A77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bzo, PDBe:3bzo, PDBj:3bzo
PDBsum3bzo
PubMed18451864
UniProtQ9AJ26

[Back to BioLiP]