Structure of PDB 3bua Chain B Binding Site BS01

Receptor Information
>3bua Chain B (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGK
EHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEF
TLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN
DLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKA
LK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bua A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R80 Q84 L87 E94 S98 L101 R102 Q105 R109 C118 S119 F120
Binding residue
(residue number reindexed from 1)		R37 Q41 L44 E51 S55 L58 R59 Q62 R66 C75 S76 F77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bua, PDBe:3bua, PDBj:3bua
PDBsum3bua
PubMed18202258
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]