Structure of PDB 3bpm Chain B Binding Site BS01

Receptor Information
>3bpm Chain B (length=232) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EANYEDVIKKYKPADAKLDRIAYDWRLHGGVTPVKDQALCGSCWAFSSVG
SVESQYAIRKKALFLFSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGLC
SQDDYPYVSNLPETCNLKRCNERYTIKSYVSIPDDKFKEALRYLGPISIS
IAASDDFAFYRGGFYDGECGAAPNHAVILVGYGMKDEKFYYYIIKNSWGS
DWGEGGYINLETDENGYKKTCSIGTEAYVPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bpm Structures of falcipain-2 and falcipain-3 bound to small molecule inhibitors: implications for substrate specificity.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G49 C51 Y90 G91 G92 Y93 N182 H183
Binding residue
(residue number reindexed from 1)		G41 C43 Y82 G83 G84 Y85 N174 H175
Enzymatic activity
Catalytic site (original residue number in PDB) Q45 C51 H183 N213
Catalytic site (residue number reindexed from 1) Q37 C43 H175 N196
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3bpm, PDBe:3bpm, PDBj:3bpm
PDBsum3bpm
PubMed19128015
UniProtQ8IIL0|FPC3_PLAF7 Falcipain-3 (Gene Name=FP3)

[Back to BioLiP]