Structure of PDB 3bl2 Chain B Binding Site BS01

Receptor Information
>3bl2 Chain B (length=131) Species: 33708 (Murid gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDS
VYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLC
PGSWTEDHELLNDCMTHFFIENNLMNHFPLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bl2 Structural and Biochemical Bases for the Inhibition of Autophagy and Apoptosis by Viral BCL-2 of Murine gamma-Herpesvirus 68
Resolution2.3 Å
Binding residue
(original residue number in PDB)		D53 Y56
Binding residue
(residue number reindexed from 1)		D49 Y52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3bl2, PDBe:3bl2, PDBj:3bl2
PDBsum3bl2
PubMed18248095
UniProtP89884|ARBH_MHV68 Apoptosis regulator Bcl-2 homolog (Gene Name=vBCL2)

[Back to BioLiP]