Structure of PDB 3bam Chain B Binding Site BS01

Receptor Information
>3bam Chain B (length=209) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVEKEFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNT
EKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFI
ENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAY
YLTDRVTNFEELEPYFELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSK
RSIKKWKDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bam The role of metals in catalysis by the restriction endonuclease BamHI.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V57 K89 G90 G91 E111 E113 T114 S119 R122 K126 T153 D154 R155 K193
Binding residue
(residue number reindexed from 1)		V57 K89 G90 G91 E111 E113 T114 S119 R122 K126 T153 D154 R155 K193
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3bam, PDBe:3bam, PDBj:3bam
PDBsum3bam
PubMed9783752
UniProtP23940|T2BA_BACAM Type II restriction enzyme BamHI (Gene Name=bamHIR)

[Back to BioLiP]