Structure of PDB 3b71 Chain B Binding Site BS01

Receptor Information
>3b71 Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVG
LALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYV
MTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b71 Structural basis for the interaction between focal adhesion kinase and CD4.
Resolution2.82 Å
Binding residue
(original residue number in PDB)		K955 L959 N991 L994 G995 I998 N999
Binding residue
(residue number reindexed from 1)		K47 L51 N83 L86 G87 I90 N91
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3b71, PDBe:3b71, PDBj:3b71
PDBsum3b71
PubMed18078954
UniProtQ05397|FAK1_HUMAN Focal adhesion kinase 1 (Gene Name=PTK2)

[Back to BioLiP]