Structure of PDB 3awr Chain B Binding Site BS01

Receptor Information
>3awr Chain B (length=64) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQ
TLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3awr Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I74 E78 Q105 L106
Binding residue
(residue number reindexed from 1)		I12 E16 Q43 L44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3awr, PDBe:3awr, PDBj:3awr
PDBsum3awr
PubMed21591667
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]