Structure of PDB 3ahu Chain B Binding Site BS01

Receptor Information
>3ahu Chain B (length=66) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLI
YKHAISTFAPQKNVQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ahu Expression, crystallization and preliminary crystallographic analysis of RNA-binding protein Hfq (YmaH) from Bacillus subtilis in complex with an RNA aptamer.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F24 L25 G28 F29 Q30 S60 T61
Binding residue
(residue number reindexed from 1)		F20 L21 G24 F25 Q26 S56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ahu, PDBe:3ahu, PDBj:3ahu
PDBsum3ahu
PubMed
UniProtO31796|HFQ_BACSU RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]