Structure of PDB 3aev Chain B Binding Site BS01

Receptor Information
>3aev Chain B (length=177) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEWEEFFKQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGE
VWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLT
DIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIA
KTAIEKLARGSPHGSVYRYLERRKKDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3aev An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R44 A46 I49 K51 K52 G53 K56 S71 S105 P106 R140 G141 R142 I144 G145 R146 K147 R149 T150 R151 H194 Y198
Binding residue
(residue number reindexed from 1)		R19 A21 I24 K26 K27 G28 K31 S46 S80 P81 R109 G110 R111 I113 G114 R115 K116 R118 T119 R120 H163 Y167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3aev, PDBe:3aev, PDBj:3aev
PDBsum3aev
PubMed20363226
UniProtO59282

[Back to BioLiP]